UPF3B antibody (70R-1348)

Rabbit polyclonal UPF3B antibody

Synonyms Polyclonal UPF3B antibody, Anti-UPF3B antibody, UPFB 3 antibody, UPFB-3 antibody, UPFB-3, Upf3 Regulator Of Nonsense Transcripts Homolog B antibody, UPF3B, UPFB 3
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen UPF3B antibody was raised using a synthetic peptide corresponding to a region with amino acids MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEAL
Assay Information UPF3B Blocking Peptide, catalog no. 33R-6132, is also available for use as a blocking control in assays to test for specificity of this UPF3B antibody

Images

Western Blot analysis using UPF3B antibody (70R-1348)

UPF3B antibody (70R-1348) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UPF3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UPF3B is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The protein is one of two functional homologs to yeast Upf3p. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UPF3B antibody (70R-1348) | UPF3B antibody (70R-1348) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors