UPP1 Blocking Peptide (33R-1068)

A synthetic peptide for use as a blocking control in assays to test for specificity of UPP1 antibody, catalog no. 70R-3171

Synonyms UPP1 control peptide, UPP1 antibody Blocking Peptide, Anti-UPP1 Blocking Peptide, Uridine Phosphorylase 1 Blocking Peptide, UDRPASE Blocking Peptide, UP Blocking Peptide, UPASE Blocking Peptide, UPP Blocking Peptide, UPP1, UPP-1, UPP 1, UPP-1 Blocking Peptide, UPP 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK
Molecular Weight 34 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UPP1 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors