UPP1 Blocking Peptide (33R-1068)
A synthetic peptide for use as a blocking control in assays to test for specificity of UPP1 antibody, catalog no. 70R-3171
Overview
Overview
| Synonyms | UPP1 control peptide, UPP1 antibody Blocking Peptide, Anti-UPP1 Blocking Peptide, Uridine Phosphorylase 1 Blocking Peptide, UDRPASE Blocking Peptide, UP Blocking Peptide, UPASE Blocking Peptide, UPP Blocking Peptide, UPP1, UPP-1, UPP 1, UPP-1 Blocking Peptide, UPP 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | ACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK |
|---|---|
| Molecular Weight | 34 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | UPP1 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product