UROD antibody (70R-1254)

Rabbit polyclonal UROD antibody raised against the N terminal of UROD

Synonyms Polyclonal UROD antibody, Anti-UROD antibody, PCT antibody, Uroporphyrinogen Decarboxylase antibody
Specificity UROD antibody was raised against the N terminal of UROD
Cross Reactivity Human
Applications IHC, WB
Immunogen UROD antibody was raised using the N terminal of UROD corresponding to a region with amino acids SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV
Assay Information UROD Blocking Peptide, catalog no. 33R-8607, is also available for use as a blocking control in assays to test for specificity of this UROD antibody


Immunohistochemical staining using UROD antibody (70R-1254)

UROD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UROD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UROD is the fifth enzyme of the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using UROD antibody (70R-1254) | UROD antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using UROD antibody (70R-1254) | UROD antibody (70R-1254) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors