Usp10 Blocking Peptide (33R-7850)

A synthetic peptide for use as a blocking control in assays to test for specificity of Usp10 antibody, catalog no. 70R-9733

Synonyms Usp10 control peptide, Usp10 antibody Blocking Peptide, Anti-Usp10 Blocking Peptide, ubiquitin specific peptidase 10 Blocking Peptide, MGC124997 Blocking Peptide, Usp10, Usp-10, Usp 10, Usp-10 Blocking Peptide, Usp 10 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RDIRPGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEML
Molecular Weight 87 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Usp10 is a hydrolase that can remove conjugated ubiquitin from target proteins such as p53/TP53, SNX3 and CFTR. It acts as an essential regulator of p53/TP53 stability: in unstressed cells, specifically deubiquitinates p53/TP53 in the cytoplasm, leading to counteract MDM2 action and stabilize p53/TP53. Following DNA damage, translocates to the nucleus and deubiquitinates p53/TP53, leading to regulate the p53/TP53-dependent DNA damage response. Usp10 does not deubiquitinate MDM2 and deubiquitinates CFTR in early endosomes, enhancing its endocytic recycling.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors