USP12 antibody (70R-3798)

Rabbit polyclonal USP12 antibody raised against the middle region of USP12

Synonyms Polyclonal USP12 antibody, Anti-USP12 antibody, USP 12, USP12L1 antibody, USP-12 antibody, USP 12 antibody, USP-12, USP12, Ubiquitin Specific Peptidase 12 antibody
Specificity USP12 antibody was raised against the middle region of USP12
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen USP12 antibody was raised using the middle region of USP12 corresponding to a region with amino acids ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG
Assay Information USP12 Blocking Peptide, catalog no. 33R-4187, is also available for use as a blocking control in assays to test for specificity of this USP12 antibody

Images

Western Blot analysis using USP12 antibody (70R-3798)

USP12 antibody (70R-3798) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of USP12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance USP12 is a deubiquitinating enzyme. USP12 has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. USP12 is not involved in deubiquitination of monoubiquitinated FANCD2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using USP12 antibody (70R-3798) | USP12 antibody (70R-3798) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors