USP47 Blocking Peptide (33R-8539)

A synthetic peptide for use as a blocking control in assays to test for specificity of USP47 antibody, catalog no. 70R-9744

Synonyms USP47 control peptide, USP47 antibody Blocking Peptide, Anti-USP47 Blocking Peptide, ubiquitin specific peptidase 47 Blocking Peptide, DKFZp686C13257 Blocking Peptide, FLJ20727 Blocking Peptide, TRFP Blocking Peptide, USP47, USP-47, USP 47, USP-47 Blocking Peptide, USP 47 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEP
Molecular Weight 147 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance USP47 is a putative ubiquitin-specific-processing protease that regulates cell growth and survival. USP47 probably regulates CDC25A expression at a transcriptional level. USP47 may be catalytically inactive although it seems to have kept all necessary active site residues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors