USP47 Blocking Peptide (33R-8539)
A synthetic peptide for use as a blocking control in assays to test for specificity of USP47 antibody, catalog no. 70R-9744
Overview
Overview
| Synonyms | USP47 control peptide, USP47 antibody Blocking Peptide, Anti-USP47 Blocking Peptide, ubiquitin specific peptidase 47 Blocking Peptide, DKFZp686C13257 Blocking Peptide, FLJ20727 Blocking Peptide, TRFP Blocking Peptide, USP47, USP-47, USP 47, USP-47 Blocking Peptide, USP 47 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEP |
|---|---|
| Molecular Weight | 147 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | USP47 is a putative ubiquitin-specific-processing protease that regulates cell growth and survival. USP47 probably regulates CDC25A expression at a transcriptional level. USP47 may be catalytically inactive although it seems to have kept all necessary active site residues. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product