Vasohibin 1 Blocking Peptide (33R-8923)

A synthetic peptide for use as a blocking control in assays to test for specificity of VASH1 antibody, catalog no. 70R-3105

Synonyms Vasohibin 1 control peptide, Vasohibin 1 antibody Blocking Peptide, Anti-Vasohibin 1 Blocking Peptide, VASH1 Blocking Peptide, KIAA1036 Blocking Peptide, Vasohibin 1, Vasohibin -1, Vasohibin 1, Vasohibin -1 Blocking Peptide, Vasohibin 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLA
Molecular Weight 41 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors