Vasohibin 1 Blocking Peptide (33R-8923)
A synthetic peptide for use as a blocking control in assays to test for specificity of VASH1 antibody, catalog no. 70R-3105
Overview
Overview
| Synonyms | Vasohibin 1 control peptide, Vasohibin 1 antibody Blocking Peptide, Anti-Vasohibin 1 Blocking Peptide, VASH1 Blocking Peptide, KIAA1036 Blocking Peptide, Vasohibin 1, Vasohibin -1, Vasohibin 1, Vasohibin -1 Blocking Peptide, Vasohibin 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLA |
|---|---|
| Molecular Weight | 41 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product