Vgll2 Blocking Peptide (33R-8492)

A synthetic peptide for use as a blocking control in assays to test for specificity of Vgll2 antibody, catalog no. 70R-9003

Synonyms Vgll2 control peptide, Vgll2 antibody Blocking Peptide, Anti-Vgll2 Blocking Peptide, vestigial like 2 homolog, Drosophila Blocking Peptide, C130057C21Rik Blocking Peptide, VITO-1 Blocking Peptide, Vgll2, Vgll-2, Vgll 2, Vgll-2 Blocking Peptide, Vgll 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SGSSSFSNPTPASVKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVV
Molecular Weight 34 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Vgll2 may act as a specific coactivator for the mammalian TEFs. It may play a role in the development of skeletal muscles.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors