Vgll2 Blocking Peptide (33R-8492)
A synthetic peptide for use as a blocking control in assays to test for specificity of Vgll2 antibody, catalog no. 70R-9003
Overview
Overview
| Synonyms | Vgll2 control peptide, Vgll2 antibody Blocking Peptide, Anti-Vgll2 Blocking Peptide, vestigial like 2 homolog, Drosophila Blocking Peptide, C130057C21Rik Blocking Peptide, VITO-1 Blocking Peptide, Vgll2, Vgll-2, Vgll 2, Vgll-2 Blocking Peptide, Vgll 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SGSSSFSNPTPASVKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVV |
|---|---|
| Molecular Weight | 34 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Vgll2 may act as a specific coactivator for the mammalian TEFs. It may play a role in the development of skeletal muscles. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product