VPS28 antibody (70R-2489)

Rabbit polyclonal VPS28 antibody

Synonyms Polyclonal VPS28 antibody, Anti-VPS28 antibody, VPS 28 antibody, VPS28, VPS 28, VPS-28 antibody, MGC60323 antibody, Vacuolar Protein Sorting 28 Homolog antibody, VPS-28
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen VPS28 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ
Assay Information VPS28 Blocking Peptide, catalog no. 33R-5993, is also available for use as a blocking control in assays to test for specificity of this VPS28 antibody


Western Blot analysis using VPS28 antibody (70R-2489)

VPS28 antibody (70R-2489) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VPS28 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using VPS28 antibody (70R-2489) | VPS28 antibody (70R-2489) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors