VPS4B Blocking Peptide (33R-10320)

A synthetic peptide for use as a blocking control in assays to test for specificity of VPS4B antibody, catalog no. 70R-10350

Synonyms VPS4B control peptide, VPS4B antibody Blocking Peptide, Anti-VPS4B Blocking Peptide, vacuolar protein sorting 4 homolog B, S. cerevisiae Blocking Peptide, MIG1 Blocking Peptide, SKD1 Blocking Peptide, SKD1B Blocking Peptide, VPS4-2 Blocking Peptide, VPS4B, VPSB-4, VPSB 4, VPSB-4 Blocking Peptide, VPSB 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues EKLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGEGESDDPEKKKLQNQ
Molecular Weight 49 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. The former share a high degree of aa sequence similarity with each other, and also with yeast Vps4 and mouse Skd1 proteins. Mouse Skd1 (suppressor of K+ transport defect 1) has been shown to be a yeast Vps4 ortholog. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast. The gene encoding this paralog has been mapped to chromosome 18; the gene for the other resides on chromosome 16.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors