VPS52 antibody (70R-3819)

Rabbit polyclonal VPS52 antibody

Synonyms Polyclonal VPS52 antibody, Anti-VPS52 antibody, VPS 52, SAC2 antibody, VPS52, Vacuolar Protein Sorting 52 Homolog antibody, RP5-1033B10 antibody, ARE1 antibody, VPS 52 antibody, dJ1033B10.5 antibody, VPS-52, DKFZp547I194 antibody, VPS-52 antibody, SACM2L antibody
Cross Reactivity Human
Applications WB
Immunogen VPS52 antibody was raised using a synthetic peptide corresponding to a region with amino acids RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF
Assay Information VPS52 Blocking Peptide, catalog no. 33R-8283, is also available for use as a blocking control in assays to test for specificity of this VPS52 antibody

Images

Western Blot analysis using VPS52 antibody (70R-3819)

VPS52 antibody (70R-3819) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VPS52 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein that is similar to the yeast suppressor of actin mutations 2 gene. The yeast protein forms a subunit of the tetrameric Golgi-associated retrograde protein complex that is involved in vesicle trafficking from from both early and late endosomes, back to the trans-Golgi network. This gene is located on chromosome 6 in a head-to-head orientation with the gene encoding ribosomal protein S18.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VPS52 antibody (70R-3819) | VPS52 antibody (70R-3819) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors