VSIG4 antibody (70R-1905)

Rabbit polyclonal VSIG4 antibody raised against the N terminal of VSIG4

Synonyms Polyclonal VSIG4 antibody, Anti-VSIG4 antibody, Z39IG antibody, VSIG 4 antibody, VSIG 4, VSIG-4, VSIG4, V-Set And Immunoglobulin Domain Containing 4 antibody, VSIG-4 antibody
Specificity VSIG4 antibody was raised against the N terminal of VSIG4
Cross Reactivity Human
Applications WB
Immunogen VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS
Assay Information VSIG4 Blocking Peptide, catalog no. 33R-9726, is also available for use as a blocking control in assays to test for specificity of this VSIG4 antibody

Images

Western Blot analysis using VSIG4 antibody (70R-1905)

VSIG4 antibody (70R-1905) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of VSIG4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VSIG4 antibody (70R-1905) | VSIG4 antibody (70R-1905) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors