WARS2 antibody (70R-2414)

Rabbit polyclonal WARS2 antibody raised against the middle region of WARS2

Synonyms Polyclonal WARS2 antibody, Anti-WARS2 antibody, WARS-2 antibody, WARS 2 antibody, WARS-2, WARS2, TrpRS antibody, WARS 2, Tryptophanyl tRNA Synthetase 2 Mitochondrial antibody
Specificity WARS2 antibody was raised against the middle region of WARS2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG
Assay Information WARS2 Blocking Peptide, catalog no. 33R-9322, is also available for use as a blocking control in assays to test for specificity of this WARS2 antibody


Western Blot analysis using WARS2 antibody (70R-2414)

WARS2 antibody (70R-2414) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WARS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. WARS2 is the mitochondrial tryptophanyl-tRNA synthetase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WARS2 antibody (70R-2414) | WARS2 antibody (70R-2414) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors