WASF3 antibody (70R-2675)

Rabbit polyclonal WASF3 antibody raised against the N terminal of WASF3

Synonyms Polyclonal WASF3 antibody, Anti-WASF3 antibody, Brush-1 antibody, Was Protein Family Member 3 antibody, WASF3, SCAR3 antibody, WASF 3, WAVE3 antibody, WASF-3 antibody, KIAA0900 antibody, WASF-3, WASF 3 antibody
Specificity WASF3 antibody was raised against the N terminal of WASF3
Cross Reactivity Human
Applications WB
Immunogen WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK
Assay Information WASF3 Blocking Peptide, catalog no. 33R-6796, is also available for use as a blocking control in assays to test for specificity of this WASF3 antibody


Western Blot analysis using WASF3 antibody (70R-2675)

WASF3 antibody (70R-2675) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WASF3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WASF3 antibody (70R-2675) | WASF3 antibody (70R-2675) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors