WASF3 antibody (70R-2676)

Rabbit polyclonal WASF3 antibody raised against the middle region of WASF3

Synonyms Polyclonal WASF3 antibody, Anti-WASF3 antibody, WASF 3, WASF-3, Brush-1 antibody, WAVE3 antibody, WASF 3 antibody, WASF-3 antibody, SCAR3 antibody, Was Protein Family Member 3 antibody, KIAA0900 antibody, WASF3
Specificity WASF3 antibody was raised against the middle region of WASF3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WASF3 antibody was raised using the middle region of WASF3 corresponding to a region with amino acids RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS
Assay Information WASF3 Blocking Peptide, catalog no. 33R-7963, is also available for use as a blocking control in assays to test for specificity of this WASF3 antibody

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WASF3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors