WBP11 antibody (70R-2408)

Rabbit polyclonal WBP11 antibody raised against the N terminal of WBP11

Synonyms Polyclonal WBP11 antibody, Anti-WBP11 antibody, WBP 11 antibody, Ww Domain Binding Protein 11 antibody, DKFZp779M1063 antibody, WBP11, WBP-11 antibody, SIPP1 antibody, WBP 11, NPWBP antibody, WBP-11
Specificity WBP11 antibody was raised against the N terminal of WBP11
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WBP11 antibody was raised using the N terminal of WBP11 corresponding to a region with amino acids GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK
Assay Information WBP11 Blocking Peptide, catalog no. 33R-3541, is also available for use as a blocking control in assays to test for specificity of this WBP11 antibody


Western Blot analysis using WBP11 antibody (70R-2408)

WBP11 antibody (70R-2408) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WBP11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WBP11 is a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. WBP11has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WBP11 antibody (70R-2408) | WBP11 antibody (70R-2408) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors