WDFY1 antibody (70R-4012)

Rabbit polyclonal WDFY1 antibody raised against the N terminal of WDFY1

Synonyms Polyclonal WDFY1 antibody, Anti-WDFY1 antibody, WDFY 1, Wd Repeat And Fyve Domain Containing 1 antibody, WDFY1, WDF1 antibody, FENS-1 antibody, WDFY-1 antibody, WDFY-1, ZFYVE17 antibody, WDFY 1 antibody
Specificity WDFY1 antibody was raised against the N terminal of WDFY1
Cross Reactivity Human
Applications WB
Immunogen WDFY1 antibody was raised using the N terminal of WDFY1 corresponding to a region with amino acids MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV
Assay Information WDFY1 Blocking Peptide, catalog no. 33R-5591, is also available for use as a blocking control in assays to test for specificity of this WDFY1 antibody


Western Blot analysis using WDFY1 antibody (70R-4012)

WDFY1 antibody (70R-4012) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDFY1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WDFY1 antibody (70R-4012) | WDFY1 antibody (70R-4012) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors