WDR13 antibody (70R-1131)

Rabbit polyclonal WDR13 antibody raised against the N terminal of WDR13

Synonyms Polyclonal WDR13 antibody, Anti-WDR13 antibody, Wd Repeat Domain 13 antibody, WDR13, WDR 13, WDR-13 antibody, WDR-13, WDR 13 antibody
Specificity WDR13 antibody was raised against the N terminal of WDR13
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen WDR13 antibody was raised using the N terminal of WDR13 corresponding to a region with amino acids GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV
Assay Information WDR13 Blocking Peptide, catalog no. 33R-3511, is also available for use as a blocking control in assays to test for specificity of this WDR13 antibody

Images

Western Blot analysis using WDR13 antibody (70R-1131)

WDR13 antibody (70R-1131) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of WDR13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR13 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. WDR13 gene is widely expressed in various tissues, and located in chromosome X. The function of this gene has not been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WDR13 antibody (70R-1131) | WDR13 antibody (70R-1131) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors