WDR35 antibody (70R-3135)

Rabbit polyclonal WDR35 antibody raised against the N terminal of WDR35

Synonyms Polyclonal WDR35 antibody, Anti-WDR35 antibody, WDR 35, WDR-35, WDR35, WDR 35 antibody, KIAA1336 antibody, WDR-35 antibody, MGC33196 antibody, Wd Repeat Domain 35 antibody
Specificity WDR35 antibody was raised against the N terminal of WDR35
Cross Reactivity Human
Applications WB
Immunogen WDR35 antibody was raised using the N terminal of WDR35 corresponding to a region with amino acids SGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS
Assay Information WDR35 Blocking Peptide, catalog no. 33R-8495, is also available for use as a blocking control in assays to test for specificity of this WDR35 antibody


Western Blot analysis using WDR35 antibody (70R-3135)

WDR35 antibody (70R-3135) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 132 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR35 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WDR35 antibody (70R-3135) | WDR35 antibody (70R-3135) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors