WDR40A antibody (70R-3213)

Rabbit polyclonal WDR40A antibody raised against the N terminal of WDR40A

Synonyms Polyclonal WDR40A antibody, Anti-WDR40A antibody, KIAA1892 antibody, WDR-40 antibody, TCC52 antibody, WDR 40 antibody, WDR40, WDR-40, WDR 40, MGC1058 antibody, Wd Repeat Domain 40A antibody, DKFZp434O125 antibody
Specificity WDR40A antibody was raised against the N terminal of WDR40A
Cross Reactivity Human
Applications WB
Immunogen WDR40A antibody was raised using the N terminal of WDR40A corresponding to a region with amino acids ARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLK
Assay Information WDR40A Blocking Peptide, catalog no. 33R-1481, is also available for use as a blocking control in assays to test for specificity of this WDR40A antibody

Images

Western Blot analysis using WDR40A antibody (70R-3213)

WDR40A antibody (70R-3213) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR40A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR40A is believed to be involved in protein binding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WDR40A antibody (70R-3213) | WDR40A antibody (70R-3213) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors