WDR49 Blocking Peptide (33R-1080)

A synthetic peptide for use as a blocking control in assays to test for specificity of WDR49 antibody, catalog no. 70R-3399

Synonyms WDR49 control peptide, WDR49 antibody Blocking Peptide, Anti-WDR49 Blocking Peptide, Wd Repeat Domain 49 Blocking Peptide, FLJ33620 Blocking Peptide, WDR49, WDR-49, WDR 49, WDR-49 Blocking Peptide, WDR 49 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ACSFPKSQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKA
Molecular Weight 79 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR49 contains 8 WD repeats. The exact function of WDR49 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors