WDR49 Blocking Peptide (33R-1080)
A synthetic peptide for use as a blocking control in assays to test for specificity of WDR49 antibody, catalog no. 70R-3399
Overview
Overview
| Synonyms | WDR49 control peptide, WDR49 antibody Blocking Peptide, Anti-WDR49 Blocking Peptide, Wd Repeat Domain 49 Blocking Peptide, FLJ33620 Blocking Peptide, WDR49, WDR-49, WDR 49, WDR-49 Blocking Peptide, WDR 49 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | ACSFPKSQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKA |
|---|---|
| Molecular Weight | 79 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | WDR49 contains 8 WD repeats. The exact function of WDR49 remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product