WDR51B antibody (70R-3215)

Rabbit polyclonal WDR51B antibody raised against the N terminal of WDR51B

Synonyms Polyclonal WDR51B antibody, Anti-WDR51B antibody, WDR 51 antibody, WDR-51, Wd Repeat Domain 51B antibody, WDR 51, FLJ41111 antibody, WDR51, WDR-51 antibody, FLJ14923 antibody, TUWD12 antibody
Specificity WDR51B antibody was raised against the N terminal of WDR51B
Cross Reactivity Human,Mouse
Applications WB
Immunogen WDR51B antibody was raised using the N terminal of WDR51B corresponding to a region with amino acids GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATAS
Assay Information WDR51B Blocking Peptide, catalog no. 33R-3452, is also available for use as a blocking control in assays to test for specificity of this WDR51B antibody

Images

Western Blot analysis using WDR51B antibody (70R-3215)

WDR51B antibody (70R-3215) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR51B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR51B contains 7 WD repeats. The function of the WDR51B protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WDR51B antibody (70R-3215) | WDR51B antibody (70R-3215) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors