WFDC5 antibody (70R-5376)

Rabbit polyclonal WFDC5 antibody raised against the N terminal of WFDC5

Synonyms Polyclonal WFDC5 antibody, Anti-WFDC5 antibody, WFDC 5, WFDC5, WFDC-5 antibody, dJ211D12.5 antibody, WFDC 5 antibody, PRG5 antibody, Wap Four-Disulfide Core Domain 5 antibody, WFDC-5, WAP1 antibody
Specificity WFDC5 antibody was raised against the N terminal of WFDC5
Cross Reactivity Human
Applications WB
Immunogen WFDC5 antibody was raised using the N terminal of WFDC5 corresponding to a region with amino acids MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV
Assay Information WFDC5 Blocking Peptide, catalog no. 33R-6386, is also available for use as a blocking control in assays to test for specificity of this WFDC5 antibody

Images

Western Blot analysis using WFDC5 antibody (70R-5376)

WFDC5 antibody (70R-5376) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 11 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WFDC5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WFDC5 antibody (70R-5376) | WFDC5 antibody (70R-5376) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors