WIPF2 Blocking Peptide (33R-1041)
A synthetic peptide for use as a blocking control in assays to test for specificity of WIPF2 antibody, catalog no. 70R-4505
Overview
Overview
| Synonyms | WIPF2 control peptide, WIPF2 antibody Blocking Peptide, Anti-WIPF2 Blocking Peptide, Was/Wasl Interacting Protein Family Member 2 Blocking Peptide, WICH Blocking Peptide, WIRE Blocking Peptide, WIPF2, WIPF-2, WIPF 2, WIPF-2 Blocking Peptide, WIPF 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPP |
|---|---|
| Molecular Weight | 46 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a WASP interacting protein (WIP)-related protein. It has been shown that this protein has a role in the WASP-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived growth factor receptor and the actin polymerization machinery. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product