WIPF2 Blocking Peptide (33R-1041)

A synthetic peptide for use as a blocking control in assays to test for specificity of WIPF2 antibody, catalog no. 70R-4505

Synonyms WIPF2 control peptide, WIPF2 antibody Blocking Peptide, Anti-WIPF2 Blocking Peptide, Was/Wasl Interacting Protein Family Member 2 Blocking Peptide, WICH Blocking Peptide, WIRE Blocking Peptide, WIPF2, WIPF-2, WIPF 2, WIPF-2 Blocking Peptide, WIPF 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPP
Molecular Weight 46 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a WASP interacting protein (WIP)-related protein. It has been shown that this protein has a role in the WASP-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived growth factor receptor and the actin polymerization machinery.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors