WNT2B antibody (70R-1066)

Affinity purified rabbit polyclonal WNT2B antibody raised against the middle region of WNT2B

Synonyms Polyclonal WNT2B antibody, Anti-WNT2B antibody, WNTB-2 antibody, WNTB 2, WNTB 2 antibody, WNT2B, WNTB-2, Wingless-Type Mmtv Integration Site Family Member 2B antibody
Specificity WNT2B antibody was raised against the middle region of WNT2B
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen WNT2B antibody was raised using the middle region of WNT2B corresponding to a region with amino acids LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT
Assay Information WNT2B Blocking Peptide, catalog no. 33R-10585, is also available for use as a blocking control in assays to test for specificity of this WNT2B antibody


Immunohistochemical staining using WNT2B antibody (70R-1066)

WNT2B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X


Host Rabbit
Method of Purification Affinity Purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT2B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WNT2B is a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using WNT2B antibody (70R-1066) | WNT2B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using WNT2B antibody (70R-1066) | WNT2B antibody (70R-1066) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors