WNT3A antibody (70R-5284)

Rabbit polyclonal WNT3A antibody raised against the N terminal of WNT3A

Synonyms Polyclonal WNT3A antibody, Anti-WNT3A antibody, WNT3A, WNTA 3, WNTA-3 antibody, MGC119419 antibody, MGC119420 antibody, Wingless-Type Mmtv Integration Site Family Member 3A antibody, WNTA-3, WNTA 3 antibody, MGC119418 antibody
Specificity WNT3A antibody was raised against the N terminal of WNT3A
Cross Reactivity Human
Applications WB
Immunogen WNT3A antibody was raised using the N terminal of WNT3A corresponding to a region with amino acids MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP
Assay Information WNT3A Blocking Peptide, catalog no. 33R-5711, is also available for use as a blocking control in assays to test for specificity of this WNT3A antibody

Images

Immunohistochemical staining using WNT3A antibody (70R-5284)

prostate

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT3A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The WNT gene family consists of structurally related genes which encode secreted signaling proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using WNT3A antibody (70R-5284) | prostate
  • Western blot analysis using WNT3A antibody (70R-5284) | Recommended WNT3A Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors