WWOX Blocking Peptide (33R-10313)

A synthetic peptide for use as a blocking control in assays to test for specificity of WWOX antibody, catalog no. 70R-10308

Synonyms WWOX control peptide, WWOX antibody Blocking Peptide, Anti-WWOX Blocking Peptide, WW domain containing oxidoreductase Blocking Peptide, D16S432E Blocking Peptide, FOR Blocking Peptide, FRA16D Blocking Peptide, HHCMA56 Blocking Peptide, PRO0128 Blocking Peptide, SDR41C1 Blocking Peptide, WOX1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues DDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSF
Molecular Weight 21 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 2 WW domains and a short-chain dehydrogenase/reductase domain (SRD). The highest normal expression of this gene is detected in hormonally regulated tissues such as testis, ovary, and prostate. This expression pattern and the presence of an SRD domain suggest a role for this gene in steroid metabolism. The encoded protein is more than 90% identical to the mouse protein, which is an essential mediator of tumor necrosis factor-alpha-induced apoptosis, suggesting a similar, important role in apoptosis for the human protein. In addition, there is evidence that this gene behaves as a suppressor of tumor growth. Alternative splicing of this gene generates transcript variants that encode different isoforms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors