XAF1 antibody (70R-3726)

Rabbit polyclonal XAF1 antibody raised against the middle region of XAF1

Synonyms Polyclonal XAF1 antibody, Anti-XAF1 antibody, XAF-1 antibody, BIRC4BP antibody, HSXIAPAF1 antibody, XAF-1, Xiap Associated Factor 1 antibody, XAF 1 antibody, XAF1, XAF 1
Specificity XAF1 antibody was raised against the middle region of XAF1
Cross Reactivity Human
Applications WB
Immunogen XAF1 antibody was raised using the middle region of XAF1 corresponding to a region with amino acids RSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPRGDKAAYDIL
Assay Information XAF1 Blocking Peptide, catalog no. 33R-8184, is also available for use as a blocking control in assays to test for specificity of this XAF1 antibody


Western Blot analysis using XAF1 antibody (70R-3726)

XAF1 antibody (70R-3726) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XAF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance X-linked inhibitor of apoptosis is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using XAF1 antibody (70R-3726) | XAF1 antibody (70R-3726) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors