XAF1 Blocking Peptide (33R-8184)
A synthetic peptide for use as a blocking control in assays to test for specificity of XAF1 antibody, catalog no. 70R-3726
Overview
Overview
| Synonyms | XAF1 control peptide, XAF1 antibody Blocking Peptide, Anti-XAF1 Blocking Peptide, Xiap Associated Factor 1 Blocking Peptide, BIRC4BP Blocking Peptide, HSXIAPAF1 Blocking Peptide, XAF1, XAF-1, XAF 1, XAF-1 Blocking Peptide, XAF 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPRGDKAAYDIL |
|---|---|
| Molecular Weight | 34 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | X-linked inhibitor of apoptosis is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product