XAF1 Blocking Peptide (33R-8780)

A synthetic peptide for use as a blocking control in assays to test for specificity of XAF1 antibody, catalog no. 70R-3725

Synonyms XAF1 control peptide, XAF1 antibody Blocking Peptide, Anti-XAF1 Blocking Peptide, Xiap Associated Factor 1 Blocking Peptide, BIRC4BP Blocking Peptide, HSXIAPAF1 Blocking Peptide, XAF1, XAF-1, XAF 1, XAF-1 Blocking Peptide, XAF 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYC
Molecular Weight 34 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance X-linked inhibitor of apoptosis is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors