XPO1 antibody (70R-4738)

Rabbit polyclonal XPO1 antibody

Synonyms Polyclonal XPO1 antibody, Anti-XPO1 antibody, XPO 1 antibody, XPO1, XPO-1, XPO-1 antibody, DKFZp686B1823 antibody, CRM1 antibody, Crm1 Homolog antibody, XPO 1, Exportin 1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen XPO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH
Assay Information XPO1 Blocking Peptide, catalog no. 33R-6744, is also available for use as a blocking control in assays to test for specificity of this XPO1 antibody


Western Blot analysis using XPO1 antibody (70R-4738)

XPO1 antibody (70R-4738) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 123 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XPO1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. XPO1 also regulates NFAT and AP-1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using XPO1 antibody (70R-4738) | XPO1 antibody (70R-4738) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors