XPOT antibody (70R-4668)

Rabbit polyclonal XPOT antibody

Synonyms Polyclonal XPOT antibody, Anti-XPOT antibody, XPO3 antibody, Exportin tRNA antibody, Nuclear Export Receptor For tRNAs antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen XPOT antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL
Assay Information XPOT Blocking Peptide, catalog no. 33R-9364, is also available for use as a blocking control in assays to test for specificity of this XPOT antibody


Western Blot analysis using XPOT antibody (70R-4668)

XPOT antibody (70R-4668) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 110 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XPOT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance XPOT belonging to the RAN-GTPase exportin family that mediates export of tRNA from the nucleus to the cytoplasm. Translocation of tRNA to the cytoplasm occurs once exportin has bound both tRNA and GTP-bound RAN.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using XPOT antibody (70R-4668) | XPOT antibody (70R-4668) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors