XRRA1 antibody (70R-4042)

Rabbit polyclonal XRRA1 antibody raised against the N terminal of XRRA1

Synonyms Polyclonal XRRA1 antibody, Anti-XRRA1 antibody, XRRA 1, XRRA 1 antibody, XRRA-1, X-Ray Radiation Resistance Associated 1 antibody, XRRA1, XRRA-1 antibody
Specificity XRRA1 antibody was raised against the N terminal of XRRA1
Cross Reactivity Human
Applications WB
Immunogen XRRA1 antibody was raised using the N terminal of XRRA1 corresponding to a region with amino acids MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKG
Assay Information XRRA1 Blocking Peptide, catalog no. 33R-5652, is also available for use as a blocking control in assays to test for specificity of this XRRA1 antibody


Western Blot analysis using XRRA1 antibody (70R-4042)

XRRA1 antibody (70R-4042) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XRRA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance XRRA1 may be involved in the response of cells to X-ray radiation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using XRRA1 antibody (70R-4042) | XRRA1 antibody (70R-4042) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors