XTP3TPA antibody (70R-1225)

Rabbit polyclonal XTP3TPA antibody raised against the N terminal of XTP3TPA

Synonyms Polyclonal XTP3TPA antibody, Anti-XTP3TPA antibody, XTPTPA-3, XTPTPA 3 antibody, CDA03 antibody, XTPTPA-3 antibody, XTP3TPA, Xtp3-Transactivated Protein A antibody, XTPTPA 3, RS21C6 antibody, MGC5627 antibody
Specificity XTP3TPA antibody was raised against the N terminal of XTP3TPA
Cross Reactivity Human
Applications WB
Immunogen XTP3TPA antibody was raised using the N terminal of XTP3TPA corresponding to a region with amino acids MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF
Assay Information XTP3TPA Blocking Peptide, catalog no. 33R-6521, is also available for use as a blocking control in assays to test for specificity of this XTP3TPA antibody


Western Blot analysis using XTP3TPA antibody (70R-1225)

XTP3TPA antibody (70R-1225) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of XTP3TPA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance XTP3TPA is involved in identical protein binding, dCTP diphosphatase activity, pyrimidine deoxyribonucleotide binding and hydrolase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using XTP3TPA antibody (70R-1225) | XTP3TPA antibody (70R-1225) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors