XTP3TPA Blocking Peptide (33R-6521)

A synthetic peptide for use as a blocking control in assays to test for specificity of XTP3TPA antibody, catalog no. 70R-1225

Synonyms XTP3TPA control peptide, XTP3TPA antibody Blocking Peptide, Anti-XTP3TPA Blocking Peptide, Xtp3-Transactivated Protein A Blocking Peptide, CDA03 Blocking Peptide, MGC5627 Blocking Peptide, RS21C6 Blocking Peptide, XTP3TPA, XTPTPA-3, XTPTPA 3, XTPTPA-3 Blocking Peptide, XTPTPA 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF
Molecular Weight 19 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance XTP3TPA is involved in identical protein binding, dCTP diphosphatase activity, pyrimidine deoxyribonucleotide binding and hydrolase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors