XTP3TPA Blocking Peptide (33R-6521)
A synthetic peptide for use as a blocking control in assays to test for specificity of XTP3TPA antibody, catalog no. 70R-1225
Overview
Overview
| Synonyms | XTP3TPA control peptide, XTP3TPA antibody Blocking Peptide, Anti-XTP3TPA Blocking Peptide, Xtp3-Transactivated Protein A Blocking Peptide, CDA03 Blocking Peptide, MGC5627 Blocking Peptide, RS21C6 Blocking Peptide, XTP3TPA, XTPTPA-3, XTPTPA 3, XTPTPA-3 Blocking Peptide, XTPTPA 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF |
|---|---|
| Molecular Weight | 19 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | XTP3TPA is involved in identical protein binding, dCTP diphosphatase activity, pyrimidine deoxyribonucleotide binding and hydrolase activity. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product