YTHDF3 antibody (70R-3209)

Rabbit polyclonal YTHDF3 antibody raised against the N terminal of YTHDF3

Synonyms Polyclonal YTHDF3 antibody, Anti-YTHDF3 antibody, YTHDF-3, Yth Domain Family Member 3 antibody, YTHDF 3, YTHDF-3 antibody, FLJ31657 antibody, YTHDF 3 antibody, YTHDF3
Specificity YTHDF3 antibody was raised against the N terminal of YTHDF3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen YTHDF3 antibody was raised using the N terminal of YTHDF3 corresponding to a region with amino acids QPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGY
Assay Information YTHDF3 Blocking Peptide, catalog no. 33R-7676, is also available for use as a blocking control in assays to test for specificity of this YTHDF3 antibody

Images

Western Blot analysis using YTHDF3 antibody (70R-3209)

YTHDF3 antibody (70R-3209) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of YTHDF3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance YTHDF3 contains 1 YTH domain. The functions of YTHDF3 remain unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using YTHDF3 antibody (70R-3209) | YTHDF3 antibody (70R-3209) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors