YWHAZ Blocking Peptide (33R-1158)
A synthetic peptide for use as a blocking control in assays to test for specificity of YWHAZ antibody, catalog no. 70R-1251
Overview
Overview
| Synonyms | YWHAZ control peptide, YWHAZ antibody Blocking Peptide, Anti-YWHAZ Blocking Peptide, Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein Blocking Peptide, KCIP-1 Blocking Peptide, MGC111427 Blocking Peptide, MGC126532 Blocking Peptide, MGC138156 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE |
|---|---|
| Molecular Weight | 28 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product