YWHAZ Blocking Peptide (33R-1158)

A synthetic peptide for use as a blocking control in assays to test for specificity of YWHAZ antibody, catalog no. 70R-1251

Synonyms YWHAZ control peptide, YWHAZ antibody Blocking Peptide, Anti-YWHAZ Blocking Peptide, Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein Blocking Peptide, KCIP-1 Blocking Peptide, MGC111427 Blocking Peptide, MGC126532 Blocking Peptide, MGC138156 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE
Molecular Weight 28 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors