ZBP1 antibody (70R-1257)

Rabbit polyclonal ZBP1 antibody raised against the middle region of ZBP1

Synonyms Polyclonal ZBP1 antibody, Anti-ZBP1 antibody, ZBP 1 antibody, ZBP-1 antibody, Z-Dna Binding Protein 1 antibody, ZBP1, ZBP 1, ZBP-1
Specificity ZBP1 antibody was raised against the middle region of ZBP1
Cross Reactivity Human
Applications WB
Immunogen ZBP1 antibody was raised using the middle region of ZBP1 corresponding to a region with amino acids LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG

Images

Western Blot analysis using ZBP1 antibody (70R-1257)

ZBP1 antibody (70R-1257) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ZBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZBP1 encodes a Z-DNA binding protein. Z-DNA formation is a dynamic process, largely controlled by the amount of supercoiling.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ZBP1 antibody (70R-1257) | ZBP1 antibody (70R-1257) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors