ZBTB40 Blocking Peptide (33R-10311)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB40 antibody, catalog no. 70R-8028

Synonyms ZBTB40 control peptide, ZBTB40 antibody Blocking Peptide, Anti-ZBTB40 Blocking Peptide, zinc finger and BTB domain containing 40 Blocking Peptide, KIAA0478 Blocking Peptide, MGC133098 Blocking Peptide, ZBTB40, ZBTB-40, ZBTB 40, ZBTB-40 Blocking Peptide, ZBTB 40 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues CSVQGQVVRDVSAPSSETFRKEPEKPQVEILSSEGAGEPHSSPELAATPG
Molecular Weight 138 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZBTB40 may be involved in transcriptional regulation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors