ZCCHC3 Blocking Peptide (33R-7843)
A synthetic peptide for use as a blocking control in assays to test for specificity of ZCCHC3 antibody, catalog no. 70R-8979
Overview
Overview
| Synonyms | ZCCHC3 control peptide, ZCCHC3 antibody Blocking Peptide, Anti-ZCCHC3 Blocking Peptide, zinc finger, CCHC domain containing 3 Blocking Peptide, C20orf99 Blocking Peptide, MGC104290 Blocking Peptide, ZCCHC3, ZCCHC-3, ZCCHC 3, ZCCHC-3 Blocking Peptide, ZCCHC 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RDFVVGALILRSIGMDPSDIYAVIQIPGSREFDVSFRSAEKLALFLRVYE |
|---|---|
| Molecular Weight | 43 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ZCCHC3 is Involved in cell differentiation and/or proliferation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product