ZDHHC19 Blocking Peptide (33R-1022)
A synthetic peptide for use as a blocking control in assays to test for specificity of ZDHHC19 antibody, catalog no. 70R-7030
Overview
Overview
| Synonyms | ZDHHC19 control peptide, ZDHHC19 antibody Blocking Peptide, Anti-ZDHHC19 Blocking Peptide, Zinc Finger Dhhc-Type Containing 19 Blocking Peptide, ZDHHC19, ZDHHC-19, ZDHHC 19, ZDHHC-19 Blocking Peptide, ZDHHC 19 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFDQGCASNWYLT |
|---|---|
| Molecular Weight | 26 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ZDHHC19 belongs to the DHHC palmitoyltransferase family. It contains 1 DHHC-type zinc finger. The exact function of ZDHHC19 remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product