ZDHHC19 Blocking Peptide (33R-1022)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZDHHC19 antibody, catalog no. 70R-7030

Synonyms ZDHHC19 control peptide, ZDHHC19 antibody Blocking Peptide, Anti-ZDHHC19 Blocking Peptide, Zinc Finger Dhhc-Type Containing 19 Blocking Peptide, ZDHHC19, ZDHHC-19, ZDHHC 19, ZDHHC-19 Blocking Peptide, ZDHHC 19 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFDQGCASNWYLT
Molecular Weight 26 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZDHHC19 belongs to the DHHC palmitoyltransferase family. It contains 1 DHHC-type zinc finger. The exact function of ZDHHC19 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors