Zfp113 Blocking Peptide (33R-10378)

A synthetic peptide for use as a blocking control in assays to test for specificity of Zfp113 antibody, catalog no. 70R-8906

Synonyms Zfp113 control peptide, Zfp113 antibody Blocking Peptide, Anti-Zfp113 Blocking Peptide, zinc finger protein 113 Blocking Peptide, 4732456B05Rik Blocking Peptide, KIAA4229 Blocking Peptide, mKIAA4229 Blocking Peptide, Zfp113, Zfp-113, Zfp 113, Zfp-113 Blocking Peptide, Zfp 113 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQSAHLIQHQR
Molecular Weight 50 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Zfp113 is involved in cell differentiation and/or proliferation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors