ZFYVE27 antibody (70R-1730)

Rabbit polyclonal ZFYVE27 antibody raised against the C terminal of ZFYVE27

Synonyms Polyclonal ZFYVE27 antibody, Anti-ZFYVE27 antibody, SPG33 antibody, RP11-459F3.2 antibody, ZFYVE-27 antibody, ZFYVE 27, ZFYVE-27, ZFYVE27, ZFYVE 27 antibody, Zinc Finger Fyve Domain Containing 27 antibody
Specificity ZFYVE27 antibody was raised against the C terminal of ZFYVE27
Cross Reactivity Human,Rat,Dog,ZebraFish
Applications WB
Immunogen ZFYVE27 antibody was raised using the C terminal of ZFYVE27 corresponding to a region with amino acids TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC
Assay Information ZFYVE27 Blocking Peptide, catalog no. 33R-9076, is also available for use as a blocking control in assays to test for specificity of this ZFYVE27 antibody


Western Blot analysis using ZFYVE27 antibody (70R-1730)

ZFYVE27 antibody (70R-1730) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ZFYVE27 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ZFYVE27 antibody (70R-1730) | ZFYVE27 antibody (70R-1730) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors