ZIC4 Blocking Peptide (33R-6389)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZIC4 antibody, catalog no. 70R-8386

Synonyms ZIC4 control peptide, ZIC4 antibody Blocking Peptide, Anti-ZIC4 Blocking Peptide, Zic family member 4 Blocking Peptide, FLJ42609 Blocking Peptide, FLJ45833 Blocking Peptide, ZIC4, ZIC-4, ZIC 4, ZIC-4 Blocking Peptide, ZIC 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEP
Molecular Weight 36 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZIC4 is a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. The specific function of ZIC4 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors