ZIC4 Blocking Peptide (33R-7999)
A synthetic peptide for use as a blocking control in assays to test for specificity of ZIC4 antibody, catalog no. 70R-8387
Overview
Overview
| Synonyms | ZIC4 control peptide, ZIC4 antibody Blocking Peptide, Anti-ZIC4 Blocking Peptide, Zic family member 4 Blocking Peptide, FLJ42609 Blocking Peptide, FLJ45833 Blocking Peptide, ZIC4, ZIC-4, ZIC 4, ZIC-4 Blocking Peptide, ZIC 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDS |
|---|---|
| Molecular Weight | 36 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ZIC4 is a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. The specific function of ZIC4 is not yet known. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product