ZNF264 Blocking Peptide (33R-1010)
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF264 antibody, catalog no. 70R-8249
Overview
Overview
| Synonyms | ZNF264 control peptide, ZNF264 antibody Blocking Peptide, Anti-ZNF264 Blocking Peptide, zinc finger protein 264 Blocking Peptide, ZNF264, ZNF-264, ZNF 264, ZNF-264 Blocking Peptide, ZNF 264 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLLV |
|---|---|
| Molecular Weight | 70 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ZNF264 may be involved in transcriptional regulation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product