ZNF414 Blocking Peptide (33R-1042)
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF414 antibody, catalog no. 70R-8390
Overview
Overview
| Synonyms | ZNF414 control peptide, ZNF414 antibody Blocking Peptide, Anti-ZNF414 Blocking Peptide, zinc finger protein 414 Blocking Peptide, MGC15716 Blocking Peptide, Zfp414 Blocking Peptide, ZNF414, ZNF-414, ZNF 414, ZNF-414 Blocking Peptide, ZNF 414 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAPSSSMSEEPGPEQAATPPVWERGGAGGMRQGSSPAPDSCQPGPGPSPG |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ZNF414 may be involved in transcriptional regulation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product