ZNF414 Blocking Peptide (33R-1042)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF414 antibody, catalog no. 70R-8390

Synonyms ZNF414 control peptide, ZNF414 antibody Blocking Peptide, Anti-ZNF414 Blocking Peptide, zinc finger protein 414 Blocking Peptide, MGC15716 Blocking Peptide, Zfp414 Blocking Peptide, ZNF414, ZNF-414, ZNF 414, ZNF-414 Blocking Peptide, ZNF 414 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAPSSSMSEEPGPEQAATPPVWERGGAGGMRQGSSPAPDSCQPGPGPSPG
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZNF414 may be involved in transcriptional regulation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors