ZNF420 antibody (70R-4414)

Rabbit polyclonal ZNF420 antibody raised against the N terminal of ZNF420

Synonyms Polyclonal ZNF420 antibody, Anti-ZNF420 antibody, ZNF 420, ZNF420, Zinc Finger Protein 420 antibody, ZNF-420 antibody, ZNF-420, ZNF 420 antibody, FLJ32191 antibody
Specificity ZNF420 antibody was raised against the N terminal of ZNF420
Cross Reactivity Human
Applications WB
Immunogen ZNF420 antibody was raised using the N terminal of ZNF420 corresponding to a region with amino acids LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN
Assay Information ZNF420 Blocking Peptide, catalog no. 33R-4917, is also available for use as a blocking control in assays to test for specificity of this ZNF420 antibody


Western Blot analysis using ZNF420 antibody (70R-4414)

ZNF420 antibody (70R-4414) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZNF420 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZNF420 contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF420 may be involved in transcriptional regulation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ZNF420 antibody (70R-4414) | ZNF420 antibody (70R-4414) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors