ZNF781 Blocking Peptide (33R-7715)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF781 antibody, catalog no. 70R-8998

Synonyms ZNF781 control peptide, ZNF781 antibody Blocking Peptide, Anti-ZNF781 Blocking Peptide, zinc finger protein 781 Blocking Peptide, FLJ37549 Blocking Peptide, MGC131783 Blocking Peptide, ZNF781, ZNF-781, ZNF 781, ZNF-781 Blocking Peptide, ZNF 781 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QRNAMYLKNVAETACNFQLTQYQISHANQKPYECQICGKPFRKRAHLTQH
Molecular Weight 38 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZNF781 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 4 C2H2-type zinc fingers. ZNF781 may be involved in transcriptional regulation. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors