ZNF781 Blocking Peptide (33R-7715)
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF781 antibody, catalog no. 70R-8998
Overview
Overview
| Synonyms | ZNF781 control peptide, ZNF781 antibody Blocking Peptide, Anti-ZNF781 Blocking Peptide, zinc finger protein 781 Blocking Peptide, FLJ37549 Blocking Peptide, MGC131783 Blocking Peptide, ZNF781, ZNF-781, ZNF 781, ZNF-781 Blocking Peptide, ZNF 781 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QRNAMYLKNVAETACNFQLTQYQISHANQKPYECQICGKPFRKRAHLTQH |
|---|---|
| Molecular Weight | 38 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ZNF781 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 4 C2H2-type zinc fingers. ZNF781 may be involved in transcriptional regulation. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product