ZP1 Blocking Peptide (33R-7410)
A synthetic peptide for use as a blocking control in assays to test for specificity of ZP1 antibody, catalog no. 70R-7021
Overview
Overview
| Synonyms | ZP1 control peptide, ZP1 antibody Blocking Peptide, Anti-ZP1 Blocking Peptide, Zona Pellucida Glycoprotein 1 Blocking Peptide, Sperm Receptor Blocking Peptide, MGC87693 Blocking Peptide, ZP1, ZP-1, ZP 1, ZP-1 Blocking Peptide, ZP 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PVGFEDSYGQEPTLGPTDSNGNSSLRPLLWAVLLLPAVALVLGFGVFVGL |
|---|---|
| Molecular Weight | 70 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product