ZP1 Blocking Peptide (33R-7410)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZP1 antibody, catalog no. 70R-7021

Synonyms ZP1 control peptide, ZP1 antibody Blocking Peptide, Anti-ZP1 Blocking Peptide, Zona Pellucida Glycoprotein 1 Blocking Peptide, Sperm Receptor Blocking Peptide, MGC87693 Blocking Peptide, ZP1, ZP-1, ZP 1, ZP-1 Blocking Peptide, ZP 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PVGFEDSYGQEPTLGPTDSNGNSSLRPLLWAVLLLPAVALVLGFGVFVGL
Molecular Weight 70 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors